Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF409 Rabbit Polyclonal Antibody (HRP)

ZNF409 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9UPU6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF409

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GGQGSPPEASLPPSAGDKEPKTKSSWQCKVCSYETNISRNLRIHMTSEKH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

XP_375065

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human OR2W1 sgRNA gene knockout kit - Lentiviral human OR2W1 sgRNA gene knockout kit (plasmid)
GTR15398129 1 Vial

Lentiviral human OR2W1 sgRNA gene knockout kit - Lentiviral human OR2W1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Comprehensive Scope 2 Binocular Seidentopf Microscope Model T-19031C
4020880 1 Each

Comprehensive Scope 2 Binocular Seidentopf Microscope Model T-19031C

Sign In for Pricing
View Details
Rat Calpain-1 catalytic subunit ELISA Kit
MBS2882038-01 48 Well

Rat Calpain-1 catalytic subunit ELISA Kit

Sign In for Pricing
View Details
Rat Calpain-1 catalytic subunit ELISA Kit
MBS2882038-02 96 Well

Rat Calpain-1 catalytic subunit ELISA Kit

Sign In for Pricing
View Details
Rat Calpain-1 catalytic subunit ELISA Kit
MBS2882038-03 5x 96 Well

Rat Calpain-1 catalytic subunit ELISA Kit

Sign In for Pricing
View Details
Rat Calpain-1 catalytic subunit ELISA Kit
MBS2882038-04 10x 96 Well

Rat Calpain-1 catalytic subunit ELISA Kit

Sign In for Pricing
View Details