Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP R, Human (HEK293, Fc)

TSLP R Protein, a receptor for TSLP, forms a functional complex with IL7R, activating STAT3 and STAT5 for cell proliferation. It also activates JAK2, aiding in hematopoietic system development. TSLP R forms a heterodimer with CRLF2 and IL7R, highlighting its role in intricate signaling pathways crucial for cellular responses and hematopoietic development. TSLP R Protein, Human (HEK293, Fc) is the recombinant human-derived TSLP R protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

TSLP R Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-r-protein-human-hek-293-fc.html

Purity

98.0

Smiles

GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK

Molecular Formula

64109 (Gene_ID) Q9HC73 (G25-K231) (Accession)

Molecular Weight

60-80 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal TSG Antibody (RM0140-7D19) [Alexa Fluor 488]
NBP1-22516AF488 0.1 mL

Rat Monoclonal TSG Antibody (RM0140-7D19) [Alexa Fluor 488]

Sign In for Pricing
View Details
MHC Class 2, Monomorphic (MHC Class II)
MBS609651-01 2 mL

MHC Class 2, Monomorphic (MHC Class II)

Sign In for Pricing
View Details
MHC Class 2, Monomorphic (MHC Class II)
MBS609651-02 5x 2 mL

MHC Class 2, Monomorphic (MHC Class II)

Sign In for Pricing
View Details
Vertnin Antibody
abx239395 100 µg

Vertnin Antibody

Sign In for Pricing
View Details
FLNC Polyclonal Antibody, Cy5 Conjugated
bs-13182R-Cy5 100 µL

FLNC Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Recombinant Human CRYBB2
MBS7617097-01 0.05 mg

Recombinant Human CRYBB2

Sign In for Pricing
View Details