Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tank Rabbit Polyclonal Antibody (Biotin)

Tank Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8VDA2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MDKNIGEQLNRAYEAFRQACMDRDSAVRELQQKQTENYEQRIREQQEQLS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_665731

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLXNC1 (VESPR, Plexin-C1, Virus-encoded Semaphorin Protein Receptor, CD232) (MaxLight 750)
MBS6234584-01 0.1 mL

PLXNC1 (VESPR, Plexin-C1, Virus-encoded Semaphorin Protein Receptor, CD232) (MaxLight 750)

Sign In for Pricing
View Details
PLXNC1 (VESPR, Plexin-C1, Virus-encoded Semaphorin Protein Receptor, CD232) (MaxLight 750)
MBS6234584-02 5x 0.1 mL

PLXNC1 (VESPR, Plexin-C1, Virus-encoded Semaphorin Protein Receptor, CD232) (MaxLight 750)

Sign In for Pricing
View Details
PVRL1 Antibody
orb107503 100 µL

PVRL1 Antibody

Sign In for Pricing
View Details
Csf1r 3'UTR GFP Stable Cell Line
TU154425 1.0 mL

Csf1r 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Eukaryotic translation initiation factor 5B Antibody (Fluoro647)
orb3156377 100 µg

Eukaryotic translation initiation factor 5B Antibody (Fluoro647)

Sign In for Pricing
View Details
Rat Chromogranin B (CHGB) ELISA Kit
TRV-0002465 96 Well Plate

Rat Chromogranin B (CHGB) ELISA Kit

Sign In for Pricing
View Details