Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Actin-related protein 2/3 complex subunit 2 (ARPC2), partial

Product Specifications

Product Name Alternative

Arp2/3 complex 34 kDa subunit; p34-ARC

Abbreviation

Recombinant Human ARPC2 protein, partial

Gene Name

ARPC2

UniProt

O15144

Expression Region

1-250aa

Organism

Homo sapiens (Human)

Target Sequence

MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDY

Tag

C-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Actin-binding component of the Arp2/3 complex, a multiprotein complex that mediates actin polymerization upon stimulation by nucleation-promoting factor (NPF) . The Arp2/3 complex mediates the formation of branched actin networks in the cytoplasm, providing the force for cell motility. Seems to contact the mother actin filament. In addition to its role in the cytoplasmic cytoskeleton, the Arp2/3 complex also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA. The Arp2/3 complex promotes homologous recombination (HR) repair in response to DNA damage by promoting nuclear actin polymerization, leading to drive motility of double-strand breaks (DSBs) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

60 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTR mouse Monoclonal Antibody (10H2)
BT-MCA1241-01 20 µL

TTR mouse Monoclonal Antibody (10H2)

Sign In for Pricing
View Details
TTR mouse Monoclonal Antibody (10H2)
BT-MCA1241-02 50 µL

TTR mouse Monoclonal Antibody (10H2)

Sign In for Pricing
View Details
TTR mouse Monoclonal Antibody (10H2)
BT-MCA1241-03 100 µL

TTR mouse Monoclonal Antibody (10H2)

Sign In for Pricing
View Details
Mouse SET Domain Containing Protein 2 ELISA Kit
MBS7279371-01 48 Well

Mouse SET Domain Containing Protein 2 ELISA Kit

Sign In for Pricing
View Details
Mouse SET Domain Containing Protein 2 ELISA Kit
MBS7279371-02 96 Well

Mouse SET Domain Containing Protein 2 ELISA Kit

Sign In for Pricing
View Details
Mouse SET Domain Containing Protein 2 ELISA Kit
MBS7279371-03 5x 96 Well

Mouse SET Domain Containing Protein 2 ELISA Kit

Sign In for Pricing
View Details