Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF365 Rabbit Polyclonal Antibody (Biotin)

ZNF365 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

UAN, Su48, ZNF365D

UniProt

Q70YC5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF365

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLFPSLKDTDLVTSSELLKP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_955522

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Grk6 (NM_001038018) Mouse Tagged ORF Clone
MR220063 10 µg

Grk6 (NM_001038018) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
IGSF1 (IGDC1, KIAA0364, PGSF2, Immunoglobulin Superfamily Member 1, Immunoglobulin-like Domain-containing Protein 1, Inhibin-binding Protein, Pituitary Gland-specific Factor 2, p120, MGC75490) (MaxLight 405) discontinued
128352-ML405 100 µL

IGSF1 (IGDC1, KIAA0364, PGSF2, Immunoglobulin Superfamily Member 1, Immunoglobulin-like Domain-containing Protein 1, Inhibin-binding Protein, Pituitary Gland-specific Factor 2, p120, MGC75490) (MaxLight 405) discontinued

Sign In for Pricing
View Details
4- (Benzyloxy) -3-methoxy-benzyl Alcohol-d2
161088 50 mg

4- (Benzyloxy) -3-methoxy-benzyl Alcohol-d2

Sign In for Pricing
View Details
Mouse Monoclonal LAG-3 Antibody (1009611) [DyLight 680]
FAB23195Y 0.1 mL

Mouse Monoclonal LAG-3 Antibody (1009611) [DyLight 680]

Sign In for Pricing
View Details
CHN1 (N-chimaerin, A-chimaerin, Alpha-chimerin, N-chimerin, NC, Rho GTPase-activating Protein 2, ARHGAP2, CHN)
124961 50 µg

CHN1 (N-chimaerin, A-chimaerin, Alpha-chimerin, N-chimerin, NC, Rho GTPase-activating Protein 2, ARHGAP2, CHN)

Sign In for Pricing
View Details
BCA Protein Assay Reagent A
20830016-2 1 L

BCA Protein Assay Reagent A

Sign In for Pricing
View Details