Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF365 Rabbit Polyclonal Antibody (HRP)

ZNF365 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UAN, Su48, ZNF365D

UniProt

Q70YC6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF365

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLFPSLKDTDLVTSSELLKP

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_955522

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C12orf43 activation kit by CRISPRa
GA112189 1 Kit

Human C12orf43 activation kit by CRISPRa

Sign In for Pricing
View Details
RGS9BP Human Gene Knockout Kit (CRISPR)
KN418269 1 Kit

RGS9BP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF154 (NM_001085384) Human Over-expression Lysate
LY421282 100 µg

ZNF154 (NM_001085384) Human Over-expression Lysate

Sign In for Pricing
View Details
DHFR Rabbit Polyclonal Antibody
TA366145 100 µL

DHFR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CALHM3 activation kit by CRISPRa
GA114687 1 Kit

Human CALHM3 activation kit by CRISPRa

Sign In for Pricing
View Details
DR5 (TNFRSF10B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A5]
TA807323AM 100 µL

DR5 (TNFRSF10B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A5]

Sign In for Pricing
View Details