Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atf6 Rabbit Polyclonal Antibody (FITC)

Atf6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ESTM4, ESTM49, AA789574, Atf6alpha, 9630036G24, 9130025P16Rik

UniProt

B2RU98

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QIDCQVMDTRILHIKSSSVPPYLRDHQRNQTSTFFGSPPTTTETTHVVST

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001074773

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human S100 Calcium Binding Protein A8/S100A8/Mrp8 Protein (C-6His)
MBS2553190-01 0.01 mg

Recombinant Human S100 Calcium Binding Protein A8/S100A8/Mrp8 Protein (C-6His)

Sign In for Pricing
View Details
Recombinant Human S100 Calcium Binding Protein A8/S100A8/Mrp8 Protein (C-6His)
MBS2553190-02 0.05 mg

Recombinant Human S100 Calcium Binding Protein A8/S100A8/Mrp8 Protein (C-6His)

Sign In for Pricing
View Details
Recombinant Human S100 Calcium Binding Protein A8/S100A8/Mrp8 Protein (C-6His)
MBS2553190-03 5x 0.05 mg

Recombinant Human S100 Calcium Binding Protein A8/S100A8/Mrp8 Protein (C-6His)

Sign In for Pricing
View Details
Mouse Vipr2 Pre-designed siRNA Set A
SI115880A 1 Each

Mouse Vipr2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Na+ CP type VIIIalpha (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-Gated sodium Channel Subunit alpha Nav1.6, SCN8A, MED) discontinued
224397-01 50 µL

Na+ CP type VIIIalpha (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-Gated sodium Channel Subunit alpha Nav1.6, SCN8A, MED) discontinued

Sign In for Pricing
View Details
Na+ CP type VIIIalpha (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-Gated sodium Channel Subunit alpha Nav1.6, SCN8A, MED) discontinued
224397-02 100 µL

Na+ CP type VIIIalpha (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-Gated sodium Channel Subunit alpha Nav1.6, SCN8A, MED) discontinued

Sign In for Pricing
View Details