Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIN Rabbit Polyclonal Antibody (HRP)

KIN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BTCD, Rts2, KIN17

UniProt

O60870

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KIN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEKTAKFIEEQVRRGLEGKEQEVPTFTELSRENDEEKVTFNLSKGACSSS

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036443

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lead oxide red [Lead (II, IV) oxide]
3123100 1 Each

Lead oxide red [Lead (II, IV) oxide]

Sign In for Pricing
View Details
CD230/Prion Antibody
orb44710 0.1 mg

CD230/Prion Antibody

Sign In for Pricing
View Details
DOK7 siRNA (Mouse)
MBS8240279-01 15 nmol

DOK7 siRNA (Mouse)

Sign In for Pricing
View Details
DOK7 siRNA (Mouse)
MBS8240279-02 30 nmol

DOK7 siRNA (Mouse)

Sign In for Pricing
View Details
DOK7 siRNA (Mouse)
MBS8240279-03 5x 30 nmol

DOK7 siRNA (Mouse)

Sign In for Pricing
View Details
PROTAC MLKL Degrader-1
HY-156591-01 5 mg

PROTAC MLKL Degrader-1

Sign In for Pricing
View Details