Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hdac6 Rabbit Polyclonal Antibody (Biotin)

Hdac6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Hdac6

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RQRKSRHNPQSPLQDSSATLKRGGKKGAVPHSSPNLAEVKKKGKMKKLSQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

125kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

XP_228753

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5- (2-Chloroacetyl) -3,3-dimethyl-2,3-dihydro-1H-indol-2-one
XEA28102-01 50 mg

5- (2-Chloroacetyl) -3,3-dimethyl-2,3-dihydro-1H-indol-2-one

Sign In for Pricing
View Details
5- (2-Chloroacetyl) -3,3-dimethyl-2,3-dihydro-1H-indol-2-one
XEA28102-02 0.5 g

5- (2-Chloroacetyl) -3,3-dimethyl-2,3-dihydro-1H-indol-2-one

Sign In for Pricing
View Details
JUN, ID (T93) (JUN, Transcription factor AP-1, Activator protein 1, Proto-oncogene c-Jun, V-jun avian sarcoma virus 17 oncogene homolog, p39) (MaxLight 650) discontinued
037222-ML650 100 µL

JUN, ID (T93) (JUN, Transcription factor AP-1, Activator protein 1, Proto-oncogene c-Jun, V-jun avian sarcoma virus 17 oncogene homolog, p39) (MaxLight 650) discontinued

Sign In for Pricing
View Details
DSCAML1 (Down Syndrome Cell Adhesion Molecule like 1, KIAA1132) (MaxLight 750) discontinued
245499-ML750 100 µL

DSCAML1 (Down Syndrome Cell Adhesion Molecule like 1, KIAA1132) (MaxLight 750) discontinued

Sign In for Pricing
View Details
AGAP5 Recombinant Protein (Human)
RP046093 100 µg

AGAP5 Recombinant Protein (Human)

Sign In for Pricing
View Details
Leptin receptor Antibody Blocking Peptide
orb1507416 500 µg

Leptin receptor Antibody Blocking Peptide

Sign In for Pricing
View Details