Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNF1B Rabbit Polyclonal Antibody (Biotin)

HNF1B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

T2D, FJHN, HNF2, LFB3, RCAD, TCF2, HPC11, LF-B3, MODY5, TCF-2, VHNF1, ADTKD3, HNF-1B, HNF1beta, HNF-1-beta

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPIL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006472

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR10X1, ID (OR10X1, OR10X1P, Olfactory receptor 10X1, Olfactory receptor OR1-14) (MaxLight 490) discontinued
039314-ML490 100 µL

OR10X1, ID (OR10X1, OR10X1P, Olfactory receptor 10X1, Olfactory receptor OR1-14) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Anti-FNDC3A Antibody Picoband® Fluoro550 Conjugated
A10398-1-Fluoro550 100 µg/Vial

Anti-FNDC3A Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
KCTD19 Antibody, Biotin conjugated
A56048-50UG 50 µg

KCTD19 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Caspase 8 (CASP8)
MBS2092595-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Caspase 8 (CASP8)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Caspase 8 (CASP8)
MBS2092595-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Caspase 8 (CASP8)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Caspase 8 (CASP8)
MBS2092595-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Caspase 8 (CASP8)

Sign In for Pricing
View Details