What is the catalog number for HNF1B Rabbit Polyclonal Antibody (Biotin)?

The catalog number for HNF1B Rabbit Polyclonal Antibody (Biotin) is orb2140688.

What sizes are available for HNF1B Rabbit Polyclonal Antibody (Biotin)?

HNF1B Rabbit Polyclonal Antibody (Biotin) is available in the following size(s): 100 µL.

Is HNF1B Rabbit Polyclonal Antibody (Biotin) in stock?

HNF1B Rabbit Polyclonal Antibody (Biotin) is currently made to order / not held in immediate stock. Contact us for lead time.

HNF1B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

T2D, FJHN, HNF2, LFB3, RCAD, TCF2, HPC11, LF-B3, MODY5, TCF-2, VHNF1, ADTKD3, HNF-1B, HNF1beta, HNF-1-beta

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPIL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.