Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aes Rabbit Polyclonal Antibody (HRP)

Aes Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A, Gr, Aes, Grg, Esp1, Grg5, Grg-5, AL024115

UniProt

P63002

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Aes

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_034477

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal VTI1b Antibody
AMM08502G 0.1 mg

Polyclonal VTI1b Antibody

Sign In for Pricing
View Details
NMDAε4 CRISPR Activation Plasmid (m2)
sc-420692-ACT-2 20 µg

NMDAε4 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
C14orf49 AAV Vector (Human) (CMV)
13860101 1 µg

C14orf49 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
MTMR11 CRISPR Activation Plasmid (m)
sc-431452-ACT 20 µg

MTMR11 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
PRPF31 Protein Vector (Mouse) (pPM-C-His)
PV219737 500 ng

PRPF31 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Defensin Alpha 6, Paneth Cell Specific (DEFa6)
MBS2073988-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Defensin Alpha 6, Paneth Cell Specific (DEFa6)

Sign In for Pricing
View Details