Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aes Rabbit Polyclonal Antibody (HRP)

Aes Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A, Gr, Aes, Grg, Esp1, Grg5, Grg-5, AL024115

UniProt

P63002

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Aes

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_034477

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPCAL1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV661533 1.0 µg DNA

HPCAL1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Human P-Cadherin (Cadherin, Placental) CLIA Kit
E-CL-H0624-01 24 Tests

Human P-Cadherin (Cadherin, Placental) CLIA Kit

Sign In for Pricing
View Details
Human P-Cadherin (Cadherin, Placental) CLIA Kit
E-CL-H0624-02 48 Tests

Human P-Cadherin (Cadherin, Placental) CLIA Kit

Sign In for Pricing
View Details
Human P-Cadherin (Cadherin, Placental) CLIA Kit
E-CL-H0624-03 96 Tests

Human P-Cadherin (Cadherin, Placental) CLIA Kit

Sign In for Pricing
View Details
Jam3 Mouse Gene Knockout Kit (CRISPR)
KN508547 1 Kit

Jam3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NUCB2 Antibody - middle region : Biotin (ARP36567_T100-Biotin)
ARP36567_T100-Biotin 100 µL

NUCB2 Antibody - middle region : Biotin (ARP36567_T100-Biotin)

Sign In for Pricing
View Details