Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AES Rabbit Polyclonal Antibody (HRP)

AES Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AES, GRG, ESP1, GRG5, AES-1, AES-2, Grg-5

UniProt

Q14CJ1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AES

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_945320

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MurC Antibody
orb821609 2 mg

MurC Antibody

Sign In for Pricing
View Details
DNAJA3 Antibody, HRP Conjugated
MBS7114267-01 0.05 mL

DNAJA3 Antibody, HRP Conjugated

Sign In for Pricing
View Details
DNAJA3 Antibody, HRP Conjugated
MBS7114267-02 0.1 mL

DNAJA3 Antibody, HRP Conjugated

Sign In for Pricing
View Details
DNAJA3 Antibody, HRP Conjugated
MBS7114267-03 5x 0.1 mL

DNAJA3 Antibody, HRP Conjugated

Sign In for Pricing
View Details
SLC39A11 Rabbit Polyclonal Antibody (PerCP)
orb2374580 100 µL

SLC39A11 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Lentiviral human GTF2H5 shRNA (UAS) - Lentiviral human GTF2H5 shRNA (UAS, GFP) (100)
GTR15336960 1 Vial

Lentiviral human GTF2H5 shRNA (UAS) - Lentiviral human GTF2H5 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details