Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AES Rabbit Polyclonal Antibody (Biotin)

AES Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AES, GRG, ESP1, GRG5, AES-1, AES-2, Grg-5

UniProt

Q14CJ1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AES

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_945320

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCG Polyclonal Antibody
E-AB-16421-01 20 µL

GCG Polyclonal Antibody

Sign In for Pricing
View Details
GCG Polyclonal Antibody
E-AB-16421-02 60 µL

GCG Polyclonal Antibody

Sign In for Pricing
View Details
GCG Polyclonal Antibody
E-AB-16421-03 120 µL

GCG Polyclonal Antibody

Sign In for Pricing
View Details
GCG Polyclonal Antibody
E-AB-16421-04 200 µL

GCG Polyclonal Antibody

Sign In for Pricing
View Details
I-309 (C-C Motif Chemokine 1, Ccl1, CCL1_HUMAN, Chemokine CC Motif Ligand 1, Inflammatory Cytokine I-309, P500, SCYA1, SISe, Small Inducible Cytokine A1, Small-inducible Cytokine A1, T Lymphocyte Secreted Protein I-309, T Lymphocyte-secreted Protein I-309, TCA3)
303371 100 µg

I-309 (C-C Motif Chemokine 1, Ccl1, CCL1_HUMAN, Chemokine CC Motif Ligand 1, Inflammatory Cytokine I-309, P500, SCYA1, SISe, Small Inducible Cytokine A1, Small-inducible Cytokine A1, T Lymphocyte Secreted Protein I-309, T Lymphocyte-secreted Protein I-309, TCA3)

Sign In for Pricing
View Details
Cystatin C/CST3, Recombinant, Human discontinued
047399-01 10 µg

Cystatin C/CST3, Recombinant, Human discontinued

Sign In for Pricing
View Details