Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BMP7 Rabbit Polyclonal Antibody (HRP)

BMP7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OP-1

UniProt

P18075

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BMP7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001710

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibroblast Growth Factor 9, Recombinant, Mouse (FGF9) discontinued
F4211-75A-01 2 µg

Fibroblast Growth Factor 9, Recombinant, Mouse (FGF9) discontinued

Sign In for Pricing
View Details
Fibroblast Growth Factor 9, Recombinant, Mouse (FGF9) discontinued
F4211-75A-02 10 µg

Fibroblast Growth Factor 9, Recombinant, Mouse (FGF9) discontinued

Sign In for Pricing
View Details
hsa-miR-4460 miRNA Antagomir
MNH02339 2x 5.0 nmol

hsa-miR-4460 miRNA Antagomir

Sign In for Pricing
View Details
ATXN7L2, CT (ATXN7L2, Ataxin-7-like protein 2)
032321 200 µL

ATXN7L2, CT (ATXN7L2, Ataxin-7-like protein 2)

Sign In for Pricing
View Details
AGAP11, NT (AGAP11, KIAA1975, Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 11, Centaurin-gamma-like protein KIAA1975) (FITC)
MBS6272138-01 0.2 mL

AGAP11, NT (AGAP11, KIAA1975, Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 11, Centaurin-gamma-like protein KIAA1975) (FITC)

Sign In for Pricing
View Details
AGAP11, NT (AGAP11, KIAA1975, Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 11, Centaurin-gamma-like protein KIAA1975) (FITC)
MBS6272138-02 5x 0.2 mL

AGAP11, NT (AGAP11, KIAA1975, Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 11, Centaurin-gamma-like protein KIAA1975) (FITC)

Sign In for Pricing
View Details