Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ID3 Rabbit Polyclonal Antibody (HRP)

ID3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HEIR-1, bHLHb25

UniProt

Q02535

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ID3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSR

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_002158

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS11 (Vacuolar Protein Sorting-associated Protein 11 Homolog, hVPS11, RING Finger Protein 108, RNF108, PP3476)
V0649-50B 100 µg

VPS11 (Vacuolar Protein Sorting-associated Protein 11 Homolog, hVPS11, RING Finger Protein 108, RNF108, PP3476)

Sign In for Pricing
View Details
ATL1 Antibody
orb1267318 400 μl

ATL1 Antibody

Sign In for Pricing
View Details
Hsa-miR-520h inhibitor
HY-RI01607-01 5 nmol

Hsa-miR-520h inhibitor

Sign In for Pricing
View Details
Hsa-miR-520h inhibitor
HY-RI01607-02 20 nmol

Hsa-miR-520h inhibitor

Sign In for Pricing
View Details
Zebrafish Prox1a Rabbit Polyclonal Antibody (APC)
orb2571668 200 µL

Zebrafish Prox1a Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Anti-Netrin 1/NTN1 Antibody Picoband® (Biotine Conjugate)
PA1662-Biotin 100 µg/Vial

Anti-Netrin 1/NTN1 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details