Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PITX1 Rabbit Polyclonal Antibody (HRP)

PITX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BFT, CCF, POTX, PTX1, LBNBG

UniProt

P78337

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PITX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_002644

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC4M (C-type Lectin Domain Family 4 Member M, CD209 Antigen-like Protein 1, DC-SIGN-related Protein, DC-SIGNR, Dendritic Cell-specific ICAM-3-grabbing Non-integrin 2, DC-SIGN2, Liver/Lymph Node-specific ICAM-3-grabbing Non-integrin, L-SIGN, CD299, CD209L, CD209L1, MGC129964, MGC47866) (APC)
125069-APC 100 µL

CLEC4M (C-type Lectin Domain Family 4 Member M, CD209 Antigen-like Protein 1, DC-SIGN-related Protein, DC-SIGNR, Dendritic Cell-specific ICAM-3-grabbing Non-integrin 2, DC-SIGN2, Liver/Lymph Node-specific ICAM-3-grabbing Non-integrin, L-SIGN, CD299, CD209L, CD209L1, MGC129964, MGC47866) (APC)

Sign In for Pricing
View Details
HIST1H3A (Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/i, Histone H3/j, Histone H3/k, Histone H3/l, HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D, H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST)
406551-01 50 µL

HIST1H3A (Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/i, Histone H3/j, Histone H3/k, Histone H3/l, HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D, H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST)

Sign In for Pricing
View Details
HIST1H3A (Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/i, Histone H3/j, Histone H3/k, Histone H3/l, HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D, H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST)
406551-02 100 µL

HIST1H3A (Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/i, Histone H3/j, Histone H3/k, Histone H3/l, HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D, H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST)

Sign In for Pricing
View Details
Glypican 1 Rabbit Polyclonal Antibody (HRP)
orb1596135 100 µL

Glypican 1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
TAPSO
GB6970-25g 25 g

TAPSO

Sign In for Pricing
View Details
IFNA2 Antibody
KC-644-01 50 μL

IFNA2 Antibody

Sign In for Pricing
View Details