Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD4 Rabbit Polyclonal Antibody (Biotin)

PSMD4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AF, ASF, S5A, AF-1, MCB1, Rpn10, pUB-R5

UniProt

P55036

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDII

Field of Research

Cancer Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002801

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Taste receptor type 2 member 4 (TAS2R4) ELISA Kit
AE16492MO-01 48 Tests

Mouse Taste receptor type 2 member 4 (TAS2R4) ELISA Kit

Sign In for Pricing
View Details
Mouse Taste receptor type 2 member 4 (TAS2R4) ELISA Kit
AE16492MO-02 96 Tests

Mouse Taste receptor type 2 member 4 (TAS2R4) ELISA Kit

Sign In for Pricing
View Details
Kv1.4 Rabbit pAb, PE-Cy5.5 conjugated
orb2864674 100 µL

Kv1.4 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
Ribosomal Protein L31 Rabbit Polyclonal Antibody
APRab17158-01 20 µL

Ribosomal Protein L31 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ribosomal Protein L31 Rabbit Polyclonal Antibody
APRab17158-02 50 µL

Ribosomal Protein L31 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ribosomal Protein L31 Rabbit Polyclonal Antibody
APRab17158-03 100 µL

Ribosomal Protein L31 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details