Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBX19 Rabbit Polyclonal Antibody (HRP)

TBX19 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TPIT, TBS19, dJ747L4.1

UniProt

O60806

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TBX19

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IKYNPFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005140

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Murashige and Skoog, With 30g/l Sucrose
CP027-010 10x 1 L

Murashige and Skoog, With 30g/l Sucrose

Sign In for Pricing
View Details
Mouse Hgsnat Pre-designed siRNA Set B
SI106174B 1 Each

Mouse Hgsnat Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse BMP and Activin Membrane Bound Inhibitor Homolog (BAMBI) ELISA Kit-Sandwich
EK5F14-01 48 Test

Mouse BMP and Activin Membrane Bound Inhibitor Homolog (BAMBI) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse BMP and Activin Membrane Bound Inhibitor Homolog (BAMBI) ELISA Kit-Sandwich
EK5F14-02 96 Tests

Mouse BMP and Activin Membrane Bound Inhibitor Homolog (BAMBI) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Rabbit Polyclonal CDK5RAP2 Antibody [Janelia Fluor 549]
NB100-767JF549 0.1 mL

Rabbit Polyclonal CDK5RAP2 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
9930023K05Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4306403 1.0 µg DNA

9930023K05Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details