Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Skil Rabbit Polyclonal Antibody (FITC)

Skil Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Sno, Skir

UniProt

D3ZWL1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LQKKQQLQMEVEMLSSSKAMKELTEEQQNLQKELESLQNEHAQRMEEFYI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

XP_001057072

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tgm1 Rat Pre-designed siRNA Set A
HY-RS28865 1 Set

Tgm1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Polyclonal Antibody to Chemokine C-C-Motif Receptor 10 (CCR10)
TRV-0048215-01 20 µL

Polyclonal Antibody to Chemokine C-C-Motif Receptor 10 (CCR10)

Sign In for Pricing
View Details
Polyclonal Antibody to Chemokine C-C-Motif Receptor 10 (CCR10)
TRV-0048215-02 100 µL

Polyclonal Antibody to Chemokine C-C-Motif Receptor 10 (CCR10)

Sign In for Pricing
View Details
Polyclonal Antibody to Chemokine C-C-Motif Receptor 10 (CCR10)
TRV-0048215-03 200 µL

Polyclonal Antibody to Chemokine C-C-Motif Receptor 10 (CCR10)

Sign In for Pricing
View Details
Polyclonal Antibody to Chemokine C-C-Motif Receptor 10 (CCR10)
TRV-0048215-04 1 mL

Polyclonal Antibody to Chemokine C-C-Motif Receptor 10 (CCR10)

Sign In for Pricing
View Details
GTF3C4 3'UTR Luciferase Stable Cell Line
TU009441 1.0 mL

GTF3C4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details