Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Skil Rabbit Polyclonal Antibody (HRP)

Skil Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sno, Skir

UniProt

D3ZWL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LQKKQQLQMEVEMLSSSKAMKELTEEQQNLQKELESLQNEHAQRMEEFYI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

XP_001057072

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EDC3 (NM_001142443) Human Over-expression Lysate
LC428097 20 µg

EDC3 (NM_001142443) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS703522 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
LYVE1 (C-term) Rabbit Polyclonal Antibody
AP11875PU-N 400 µL

LYVE1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NCF4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E3]
TA809196AM 100 µL

NCF4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E3]

Sign In for Pricing
View Details
CEACAM1 (NM_001184815) Human Over-expression Lysate
LY433126 100 µg

CEACAM1 (NM_001184815) Human Over-expression Lysate

Sign In for Pricing
View Details
POF1B (NM_024921) Human Over-expression Lysate
LC403038 20 µg

POF1B (NM_024921) Human Over-expression Lysate

Sign In for Pricing
View Details