Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUVBL2 Rabbit Polyclonal Antibody (FITC)

RUVBL2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RVB2, TIH2, ECP51, TIP48, CGI-46, ECP-51, INO80J, REPTIN, TIP49B, TAP54-beta

UniProt

Q9Y230

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RUVBL2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKI

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006657

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKN2A Antibody
orb2684087-01 50 µL

CDKN2A Antibody

Sign In for Pricing
View Details
CDKN2A Antibody
orb2684087-02 100 µL

CDKN2A Antibody

Sign In for Pricing
View Details
CDKN2A Antibody
orb2684087-03 200 µL

CDKN2A Antibody

Sign In for Pricing
View Details
FOLR1, NT (FOLR1, FOLR, Folate receptor alpha, Adult folate-binding protein, Folate receptor 1, Folate receptor, adult, KB cells FBP, Ovarian tumor-associated antigen MOv18) (MaxLight 550)
MBS6299606-01 0.1 mL

FOLR1, NT (FOLR1, FOLR, Folate receptor alpha, Adult folate-binding protein, Folate receptor 1, Folate receptor, adult, KB cells FBP, Ovarian tumor-associated antigen MOv18) (MaxLight 550)

Sign In for Pricing
View Details
FOLR1, NT (FOLR1, FOLR, Folate receptor alpha, Adult folate-binding protein, Folate receptor 1, Folate receptor, adult, KB cells FBP, Ovarian tumor-associated antigen MOv18) (MaxLight 550)
MBS6299606-02 5x 0.1 mL

FOLR1, NT (FOLR1, FOLR, Folate receptor alpha, Adult folate-binding protein, Folate receptor 1, Folate receptor, adult, KB cells FBP, Ovarian tumor-associated antigen MOv18) (MaxLight 550)

Sign In for Pricing
View Details
SNRPB Rabbit Polyclonal Antibody (Biotin)
orb452254 100 µL

SNRPB Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details