Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUVBL2 Rabbit Polyclonal Antibody (Biotin)

RUVBL2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RVB2, TIH2, ECP51, TIP48, CGI-46, ECP-51, INO80J, REPTIN, TIP49B, TAP54-beta

UniProt

Q9Y230

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RUVBL2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKI

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006657

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD146/Mcam Rabbit Polyclonal Antibody (HRP)
orb2606361 100 µg

CD146/Mcam Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Polyclonal Antibody to Insulin Like Protein 6 (INSL6)
TRV-0056386-01 20 µL

Polyclonal Antibody to Insulin Like Protein 6 (INSL6)

Sign In for Pricing
View Details
Polyclonal Antibody to Insulin Like Protein 6 (INSL6)
TRV-0056386-02 100 µL

Polyclonal Antibody to Insulin Like Protein 6 (INSL6)

Sign In for Pricing
View Details
Polyclonal Antibody to Insulin Like Protein 6 (INSL6)
TRV-0056386-03 200 µL

Polyclonal Antibody to Insulin Like Protein 6 (INSL6)

Sign In for Pricing
View Details
Polyclonal Antibody to Insulin Like Protein 6 (INSL6)
TRV-0056386-04 1 mL

Polyclonal Antibody to Insulin Like Protein 6 (INSL6)

Sign In for Pricing
View Details
Anti-Danio rerio (Zebrafish) tead3a Antibody APC Conjugated
DZ41908-APC 200 µL/Vial

Anti-Danio rerio (Zebrafish) tead3a Antibody APC Conjugated

Sign In for Pricing
View Details