Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUVBL2 Rabbit Polyclonal Antibody (FITC)

RUVBL2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RVB2, TIH2, ECP51, TIP48, CGI-46, ECP-51, INO80J, REPTIN, TIP49B, TAP54-beta

UniProt

Q9Y230

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RUVBL2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITID

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006657

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALPI (Intestinal-type Alkaline Phosphatase, Intestinal Alkaline Phosphatase, IAP) (MaxLight 405)
MBS6188834-01 0.1 mL

ALPI (Intestinal-type Alkaline Phosphatase, Intestinal Alkaline Phosphatase, IAP) (MaxLight 405)

Sign In for Pricing
View Details
ALPI (Intestinal-type Alkaline Phosphatase, Intestinal Alkaline Phosphatase, IAP) (MaxLight 405)
MBS6188834-02 5x 0.1 mL

ALPI (Intestinal-type Alkaline Phosphatase, Intestinal Alkaline Phosphatase, IAP) (MaxLight 405)

Sign In for Pricing
View Details
CDC45L (Cell Division Control Protein 45 Homolog, PORC-PI-1, CDC45, CDC45L2, UNQ374/PRO710) (MaxLight 405) discontinued
124755-ML405 100 µL

CDC45L (Cell Division Control Protein 45 Homolog, PORC-PI-1, CDC45, CDC45L2, UNQ374/PRO710) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human CRLF1 Knockout A549 cell line
GTR15406546 1 Vial

Human CRLF1 Knockout A549 cell line

Sign In for Pricing
View Details
Mouse Phosphatidylglycerol (PG) ELISA Kit
MBS9353127-01 48 Well

Mouse Phosphatidylglycerol (PG) ELISA Kit

Sign In for Pricing
View Details
Mouse Phosphatidylglycerol (PG) ELISA Kit
MBS9353127-02 96 Well

Mouse Phosphatidylglycerol (PG) ELISA Kit

Sign In for Pricing
View Details