Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIRT1 Rabbit Polyclonal Antibody (FITC)

SIRT1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SIR2, SIR2L1, SIR2alpha

UniProt

Q96EB6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SIRT1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKI

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036370

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFTS Virus HB29 Peptide
6651P 0.05 mg

SFTS Virus HB29 Peptide

Sign In for Pricing
View Details
Neuromedin S (NMS) amide (Human) - Cy3 Labeled
FC3-045-86 1 nmol

Neuromedin S (NMS) amide (Human) - Cy3 Labeled

Sign In for Pricing
View Details
PLA2G2A (Phospholipase A2 (Group II A) Human ELISA Kit
F9219 96 Tests

PLA2G2A (Phospholipase A2 (Group II A) Human ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Kcnip1 shRNA (UAS) - Lentiviral mouse Kcnip1 shRNA (UAS, iRFP) (100)
GTR15152715 1 Vial

Lentiviral mouse Kcnip1 shRNA (UAS) - Lentiviral mouse Kcnip1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CEP164 Rabbit Polyclonal Antibody
orb625717-01 50 µg

CEP164 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CEP164 Rabbit Polyclonal Antibody
orb625717-02 100 µg

CEP164 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details