Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIRT1 Rabbit Polyclonal Antibody (HRP)

SIRT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SIR2, SIR2L1, SIR2alpha

UniProt

Q96EB6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SIRT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKI

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036370

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse RAGE (Renal Tumor Antigen) ELISA Kit
EK247953 96 Well

Mouse RAGE (Renal Tumor Antigen) ELISA Kit

Sign In for Pricing
View Details
ANXA1 Rabbit Polyclonal Antibody (Biotin)
orb2131685 100 µL

ANXA1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
GPCR TGR7 Rabbit Polyclonal Antibody (APC)
orb996569 100 µL

GPCR TGR7 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Mouse Hnrnph3 Pre-designed siRNA Set A
SI106267A 1 Each

Mouse Hnrnph3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Tctex1d2 Mouse shRNA Plasmid (Locus ID 66061)
TL511588 1 Kit

Tctex1d2 Mouse shRNA Plasmid (Locus ID 66061)

Sign In for Pricing
View Details
NLRP2 Antibody
A67304-50UL 50 μL

NLRP2 Antibody

Sign In for Pricing
View Details