Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD6 Rabbit Polyclonal Antibody (Biotin)

PSMD6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

S10, Rpn7, p42A, p44S10, SGA-113M

UniProt

Q15008

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055629

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal beta Amyloid Antibody (AB9) [HRP]
NBP2-50055H 0.1 mL

Mouse Monoclonal beta Amyloid Antibody (AB9) [HRP]

Sign In for Pricing
View Details
Recombinant Human CD326/EPCAM Protein, C-Fc
orb3152916-01 50 µg

Recombinant Human CD326/EPCAM Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human CD326/EPCAM Protein, C-Fc
orb3152916-02 100 µg

Recombinant Human CD326/EPCAM Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human CD326/EPCAM Protein, C-Fc
orb3152916-03 1 mg

Recombinant Human CD326/EPCAM Protein, C-Fc

Sign In for Pricing
View Details
ST5 discontinued
394921 200 µL

ST5 discontinued

Sign In for Pricing
View Details
RGD1565787 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV649586 1.0 µg DNA

RGD1565787 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details