Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DACH2 Rabbit Polyclonal Antibody (HRP)

DACH2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q96NX9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DACH2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_444511

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UCP1, Recombinant, Human, His-Tag discontinued
591608-01 20 µg

UCP1, Recombinant, Human, His-Tag discontinued

Sign In for Pricing
View Details
UCP1, Recombinant, Human, His-Tag discontinued
591608-02 100 µg

UCP1, Recombinant, Human, His-Tag discontinued

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YLR257W Polyclonal Antibody
MBS7186502 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YLR257W Polyclonal Antibody

Sign In for Pricing
View Details
SWAP70 (SWAP-70 Protein, FLJ39540, HSPC321, KIAA0640, SWAP-70) (Biotin)
252302-Biotin 100 µL

SWAP70 (SWAP-70 Protein, FLJ39540, HSPC321, KIAA0640, SWAP-70) (Biotin)

Sign In for Pricing
View Details
Recombinant Dog Tumor necrosis factor (TNF)
MBS961289-01 0.05 mg (E-Coli)

Recombinant Dog Tumor necrosis factor (TNF)

Sign In for Pricing
View Details
Recombinant Dog Tumor necrosis factor (TNF)
MBS961289-02 0.05 mg (Yeast)

Recombinant Dog Tumor necrosis factor (TNF)

Sign In for Pricing
View Details