Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DACH2 Rabbit Polyclonal Antibody (Biotin)

DACH2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q96NX9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DACH2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_444511

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Rabbit Myokinase Antibody
orb21146 10 mg

Sheep Rabbit Myokinase Antibody

Sign In for Pricing
View Details
Mouse Anapc2 Pre-designed siRNA Set B
SI100604B 1 Each

Mouse Anapc2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Calcium Silicate Powder
CER-0019 100 g

Calcium Silicate Powder

Sign In for Pricing
View Details
PPARd (Peroxisome Proliferator Activated Receptor, delta, PPAR-delta, Peroxisome Proliferator-Activated Receptor beta, PPAR-beta, Nuclear Receptor Subfamily 1 Group C Member 2, Nuclear Hormone Receptor 1, NUC1, Ppard, Nr1c2, Pparb) discontinued
P5505-04E 50 µg

PPARd (Peroxisome Proliferator Activated Receptor, delta, PPAR-delta, Peroxisome Proliferator-Activated Receptor beta, PPAR-beta, Nuclear Receptor Subfamily 1 Group C Member 2, Nuclear Hormone Receptor 1, NUC1, Ppard, Nr1c2, Pparb) discontinued

Sign In for Pricing
View Details
UPA Receptor Polyclonal Antibody PE Conjugated
orb1540607 100 µL

UPA Receptor Polyclonal Antibody PE Conjugated

Sign In for Pricing
View Details
PDCD6IP (AIP1, ALIX, KIAA1375, Programmed Cell Death 6-interacting Protein, ALG-2-interacting Protein 1, Hp95)
131037 50 µg

PDCD6IP (AIP1, ALIX, KIAA1375, Programmed Cell Death 6-interacting Protein, ALG-2-interacting Protein 1, Hp95)

Sign In for Pricing
View Details