Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DACH2 Rabbit Polyclonal Antibody (FITC)

DACH2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q96NX9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DACH2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QALKQATTSDSGLRMLKDTGIPDIEIENNGTPHDSAAMQGGNYYCLEMAQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Rab11fip5 qPCR Primer Pair
QM26486S 200 Tests

Mouse Rab11fip5 qPCR Primer Pair

Sign In for Pricing
View Details
Anti-Human CD45/PTPRC Antibody (BC8), PerCP
FHC34014 100 Tests

Anti-Human CD45/PTPRC Antibody (BC8), PerCP

Sign In for Pricing
View Details
FNTB (Protein Farnesyltransferase Subunit beta, FTase-beta, CAAX Farnesyltransferase Subunit beta, RAS Proteins Prenyltransferase Subunit beta) (MaxLight 490)
MBS6200876-01 0.1 mL

FNTB (Protein Farnesyltransferase Subunit beta, FTase-beta, CAAX Farnesyltransferase Subunit beta, RAS Proteins Prenyltransferase Subunit beta) (MaxLight 490)

Sign In for Pricing
View Details
FNTB (Protein Farnesyltransferase Subunit beta, FTase-beta, CAAX Farnesyltransferase Subunit beta, RAS Proteins Prenyltransferase Subunit beta) (MaxLight 490)
MBS6200876-02 5x 0.1 mL

FNTB (Protein Farnesyltransferase Subunit beta, FTase-beta, CAAX Farnesyltransferase Subunit beta, RAS Proteins Prenyltransferase Subunit beta) (MaxLight 490)

Sign In for Pricing
View Details
DDX42 Rabbit Polyclonal Antibody (HRP)
orb2131899 100 µL

DDX42 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Phospho-NFKB1 (Ser337) Rabbit Polyclonal Antibody (PE-Cy7)
orb895370 100 µL

Phospho-NFKB1 (Ser337) Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details