Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DACH2 Rabbit Polyclonal Antibody (HRP)

DACH2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q96NX9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DACH2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QALKQATTSDSGLRMLKDTGIPDIEIENNGTPHDSAAMQGGNYYCLEMAQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXLNB Antibody - N-terminal region
MBS3219012-01 0.1 mL

TXLNB Antibody - N-terminal region

Sign In for Pricing
View Details
TXLNB Antibody - N-terminal region
MBS3219012-02 5x 0.1 mL

TXLNB Antibody - N-terminal region

Sign In for Pricing
View Details
Anti-Human NGF/Beta-NGF Antibody (SAA0435)
HF909107 100 µg

Anti-Human NGF/Beta-NGF Antibody (SAA0435)

Sign In for Pricing
View Details
ICOS Mouse Monoclonal Antibody [Clone 1B5]
E45M21079V-2 50 µL

ICOS Mouse Monoclonal Antibody [Clone 1B5]

Sign In for Pricing
View Details
Rabbit anti-DOCK7 Antibody, Affinity Purified
MBS3903638-01 0.01 mg

Rabbit anti-DOCK7 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-DOCK7 Antibody, Affinity Purified
MBS3903638-02 0.1 mg

Rabbit anti-DOCK7 Antibody, Affinity Purified

Sign In for Pricing
View Details