Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BHLHB5 Rabbit Polyclonal Antibody (FITC)

BHLHB5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Beta3, BHLHB5, Beta3a, CAGL85, TNRC20

UniProt

Q8NFJ8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BHLHB5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPR

Field of Research

Neuroscience

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689627

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF594 conjugate, 0.1mg/mL
BNC942497-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
gamma C Crystallin (CRYGC) Human shRNA Plasmid Kit (Locus ID 1420)
TL305205 1 Kit

gamma C Crystallin (CRYGC) Human shRNA Plasmid Kit (Locus ID 1420)

Sign In for Pricing
View Details
Recombinant Human CCL22 (C-hFc)
BP1086-1mg 1 mg

Recombinant Human CCL22 (C-hFc)

Sign In for Pricing
View Details
ASFV CP204L Protein (N-His, African swine fever virus (ASFV) )
P500698 100 µg

ASFV CP204L Protein (N-His, African swine fever virus (ASFV) )

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Betacellulin (bTC)
MBS2037950-01 0.1 mL

APC-Linked Polyclonal Antibody to Betacellulin (bTC)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Betacellulin (bTC)
MBS2037950-02 0.2 mL

APC-Linked Polyclonal Antibody to Betacellulin (bTC)

Sign In for Pricing
View Details