Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BHLHB5 Rabbit Polyclonal Antibody (HRP)

BHLHB5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Beta3, BHLHB5, Beta3a, CAGL85, TNRC20

UniProt

Q8NFJ8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BHLHB5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPR

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689627

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Lung
CP565828 150 µg

Tissue Protein Lysate, Lung

Sign In for Pricing
View Details
SIRT6 Recombinant Rabbit monoclonal Antibody
HA723265 100 µL

SIRT6 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TRITC Conjugated Rabbit Affinity Purified Antibody to Bovine IgG Antibody
RAF-511-1 1 mL

TRITC Conjugated Rabbit Affinity Purified Antibody to Bovine IgG Antibody

Sign In for Pricing
View Details
FMOC-Asp (5/6-FAM) -OH
5003-AAT 100 mg

FMOC-Asp (5/6-FAM) -OH

Sign In for Pricing
View Details
SLC6A19 (NM_001003841) Human Over-expression Lysate
LC424027 20 µg

SLC6A19 (NM_001003841) Human Over-expression Lysate

Sign In for Pricing
View Details
MUC2 (Mucin 2) (rMLP/842), CF640R conjugate, 0.1mg/mL
BNC403609-500 1x 500 µL

MUC2 (Mucin 2) (rMLP/842), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details