Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BHLHB5 Rabbit Polyclonal Antibody (HRP)

BHLHB5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Beta3, BHLHB5, Beta3a, CAGL85, TNRC20

UniProt

Q8NFJ8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BHLHB5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPR

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_689627

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Muscle Specific Actin (MSA/953), CF640R conjugate, 0.1mg/mL
BNC400953-100 1x 100 µL

Muscle Specific Actin (MSA/953), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGLN2 Mouse Monoclonal Antibody [Clone ID: OTI7H3]
CF808584 100 µg

EGLN2 Mouse Monoclonal Antibody [Clone ID: OTI7H3]

Sign In for Pricing
View Details
MTP18 (MTFP1) (NM_001003704) Human Over-expression Lysate
LC423990 20 µg

MTP18 (MTFP1) (NM_001003704) Human Over-expression Lysate

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (M3A7), CF568 conjugate, 0.1mg/mL
BNC681827-100 1x 100 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (M3A7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Freeze Dryer BFFT-105-A
BFFT-105-A 1 Unit

Freeze Dryer BFFT-105-A

Sign In for Pricing
View Details
SAAL1 (C-term) Rabbit Polyclonal Antibody
AP53787PU-N 400 µL

SAAL1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details