Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eya2 Rabbit Polyclonal Antibody (HRP)

Eya2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6UN47

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EAPHNVSQSSESLAGDYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_569111

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRTG Rabbit Polyclonal Antibody (APC-Cy7)
orb2469352 100 µL

PRTG Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Immunoglobulin-Like Transcript 2 (ILT2, CD85j)(Carboxyfluorescein)
MBS6507742-01 100 Tests

Immunoglobulin-Like Transcript 2 (ILT2, CD85j)(Carboxyfluorescein)

Sign In for Pricing
View Details
Immunoglobulin-Like Transcript 2 (ILT2, CD85j)(Carboxyfluorescein)
MBS6507742-02 5x 100 Tests

Immunoglobulin-Like Transcript 2 (ILT2, CD85j)(Carboxyfluorescein)

Sign In for Pricing
View Details
Leucine zipper putative Tumor suppressor 1 (LZTS1) Human ELISA Kit
E6352 96 Tests

Leucine zipper putative Tumor suppressor 1 (LZTS1) Human ELISA Kit

Sign In for Pricing
View Details
FBL polyclonal antibody
orb646215-01 50 μL

FBL polyclonal antibody

Sign In for Pricing
View Details
FBL polyclonal antibody
orb646215-02 100 µL

FBL polyclonal antibody

Sign In for Pricing
View Details