Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTX2 Rabbit Polyclonal Antibody (FITC)

OTX2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CPHD6, MCOPS5

UniProt

P32243

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OTX2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPV

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_068374

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NOX2 Rabbit Polyclonal Antibody
PA1247-.1 100 µL

Anti-NOX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human HS2ST1 shRNA (UAS) - Lentiviral human HS2ST1 shRNA (UAS) (100)
GTR15320745 1 Vial

Lentiviral human HS2ST1 shRNA (UAS) - Lentiviral human HS2ST1 shRNA (UAS) (100)

Sign In for Pricing
View Details
Sheep Guinea Pig IgM (Fc specific) Antibody
orb22432 1 mL

Sheep Guinea Pig IgM (Fc specific) Antibody

Sign In for Pricing
View Details
SLC22A17 (Solute Carrier Family 22 Member 17, 24p3 Receptor, 24p3R, Brain-type Organic Cation Transporter, Lipocalin-2 Receptor, Neutrophil Gelatinase-associated Lipocalin Receptor, NgalR, BOCT, BOIT)
146298 100 µg

SLC22A17 (Solute Carrier Family 22 Member 17, 24p3 Receptor, 24p3R, Brain-type Organic Cation Transporter, Lipocalin-2 Receptor, Neutrophil Gelatinase-associated Lipocalin Receptor, NgalR, BOCT, BOIT)

Sign In for Pricing
View Details
HLA-DQA1, NT (HLA-DQA1, HLA class II histocompatibility antigen, DQ alpha 1 chain, DC-1 alpha chain, DC-alpha, HLA-DCA, MHC class II DQA1) (MaxLight 550)
MBS6307117-01 0.1 mL

HLA-DQA1, NT (HLA-DQA1, HLA class II histocompatibility antigen, DQ alpha 1 chain, DC-1 alpha chain, DC-alpha, HLA-DCA, MHC class II DQA1) (MaxLight 550)

Sign In for Pricing
View Details
HLA-DQA1, NT (HLA-DQA1, HLA class II histocompatibility antigen, DQ alpha 1 chain, DC-1 alpha chain, DC-alpha, HLA-DCA, MHC class II DQA1) (MaxLight 550)
MBS6307117-02 5x 0.1 mL

HLA-DQA1, NT (HLA-DQA1, HLA class II histocompatibility antigen, DQ alpha 1 chain, DC-1 alpha chain, DC-alpha, HLA-DCA, MHC class II DQA1) (MaxLight 550)

Sign In for Pricing
View Details