Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pcbd1 Rabbit Polyclonal Antibody (HRP)

Pcbd1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dco, Pcb, Pcd, Phs, Dcoh, Pcbd

UniProt

P61458

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079549

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOLH1/PSMA Human Monoclonal Antibody
orb2975332-01 50 µg

FOLH1/PSMA Human Monoclonal Antibody

Sign In for Pricing
View Details
FOLH1/PSMA Human Monoclonal Antibody
orb2975332-02 100 µg

FOLH1/PSMA Human Monoclonal Antibody

Sign In for Pricing
View Details
C10orf65 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV812244 1.0 µg DNA

C10orf65 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
IL-36A Peptide
orb1232003 0.05 mg

IL-36A Peptide

Sign In for Pricing
View Details
Serping1 3'UTR GFP Stable Cell Line
TU168646 1.0 mL

Serping1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mini Plus Plasmid DNA Extraction
GF2002 250 Preparations

Mini Plus Plasmid DNA Extraction

Sign In for Pricing
View Details