Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pcbd1 Rabbit Polyclonal Antibody (Biotin)

Pcbd1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Dco, Pcb, Pcd, Phs, Dcoh, Pcbd

UniProt

P61458

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079549

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Herc2 3'UTR Lenti-reporter-Luc Vector
23194086 1.0 µg

Herc2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
ARMCX3 (ALEX3, Armadillo Repeat-containing X-linked Protein 3, ARM Protein Lost in Epithelial Cancers on Chromosome X 3, DKFZp781N1954, KIAA0443, MGC12199, dJ545K15.2) (PE)
MBS6370385-01 0.1 mL

ARMCX3 (ALEX3, Armadillo Repeat-containing X-linked Protein 3, ARM Protein Lost in Epithelial Cancers on Chromosome X 3, DKFZp781N1954, KIAA0443, MGC12199, dJ545K15.2) (PE)

Sign In for Pricing
View Details
ARMCX3 (ALEX3, Armadillo Repeat-containing X-linked Protein 3, ARM Protein Lost in Epithelial Cancers on Chromosome X 3, DKFZp781N1954, KIAA0443, MGC12199, dJ545K15.2) (PE)
MBS6370385-02 5x 0.1 mL

ARMCX3 (ALEX3, Armadillo Repeat-containing X-linked Protein 3, ARM Protein Lost in Epithelial Cancers on Chromosome X 3, DKFZp781N1954, KIAA0443, MGC12199, dJ545K15.2) (PE)

Sign In for Pricing
View Details
Glycophorin A CRISPR Activation Plasmid (m2)
sc-420742-ACT-2 20 µg

Glycophorin A CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Agap2 (NM_001301014) Mouse Tagged ORF Clone
MR231643 10 µg

Agap2 (NM_001301014) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) Spn88Ea Polyclonal Antibody
MBS7147564 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) Spn88Ea Polyclonal Antibody

Sign In for Pricing
View Details