Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRC Rabbit Polyclonal Antibody (HRP)

SRC Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ASV, SRC1, THC6, c-SRC, p60-Src

UniProt

P12931

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SRC

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005408

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3R6 (Phosphoinositide-3-Kinase, Regulatory Subunit 6, C17orf38, DKFZp666P158, FLJ34500, HsT41028, p84, p87 (PIKAP), p87PIKAP) (MaxLight 550)
250108-ML550 100 µL

PIK3R6 (Phosphoinositide-3-Kinase, Regulatory Subunit 6, C17orf38, DKFZp666P158, FLJ34500, HsT41028, p84, p87 (PIKAP), p87PIKAP) (MaxLight 550)

Sign In for Pricing
View Details
Zfp219 Recombinant Protein (Mouse)
RP186779 100 µg

Zfp219 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Atox1 Protein Vector (Rat) (pPM-C-His)
PV255169 500 ng

Atox1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
DLGAP5 Rabbit Polyclonal Antibody
orb627874-01 50 µg

DLGAP5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DLGAP5 Rabbit Polyclonal Antibody
orb627874-02 100 µg

DLGAP5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human IgA1 heavy chain Antibody
orb1735857 0.1 mg

Human IgA1 heavy chain Antibody

Sign In for Pricing
View Details