Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCOR1 Rabbit Polyclonal Antibody (FITC)

NCOR1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

N-CoR, TRAC1, N-CoR1, hN-CoR, PPP1R109

UniProt

Q60974

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NCOR1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

270kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast

Tested Applications

IHC, WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arrb1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6700503 1.0 µg DNA

Arrb1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
RAB40C, ID (RAB40C, RARL, RASL8C, Ras-related protein Rab-40C, Rar-like protein, Ras-like protein family member 8C, SOCS box-containing protein RAR3) (APC) discontinued
040773-APC 200 µL

RAB40C, ID (RAB40C, RARL, RASL8C, Ras-related protein Rab-40C, Rar-like protein, Ras-like protein family member 8C, SOCS box-containing protein RAR3) (APC) discontinued

Sign In for Pricing
View Details
GABA T-3 (G-6) P
sc-376001 P 100 µg - 0.5 mL

GABA T-3 (G-6) P

Sign In for Pricing
View Details
APRIL, blocking, Antibody
MBS637419-01 0.1 mg

APRIL, blocking, Antibody

Sign In for Pricing
View Details
APRIL, blocking, Antibody
MBS637419-02 5x 0.1 mg

APRIL, blocking, Antibody

Sign In for Pricing
View Details
REDD-1 CRISPR/Cas9 KO Plasmid (h2)
sc-401797-KO-2 20 µg

REDD-1 CRISPR/Cas9 KO Plasmid (h2)

Sign In for Pricing
View Details