Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCOR1 Rabbit Polyclonal Antibody (HRP)

NCOR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

N-CoR, TRAC1, N-CoR1, hN-CoR, PPP1R109

UniProt

Q60974

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NCOR1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

270kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast

Tested Applications

IHC, WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium gilvum UPF0353 protein Mflv_3659 (Mflv_3659)
orb2926269-01 20 µg

Recombinant Mycobacterium gilvum UPF0353 protein Mflv_3659 (Mflv_3659)

Sign In for Pricing
View Details
Recombinant Mycobacterium gilvum UPF0353 protein Mflv_3659 (Mflv_3659)
orb2926269-02 100 µg

Recombinant Mycobacterium gilvum UPF0353 protein Mflv_3659 (Mflv_3659)

Sign In for Pricing
View Details
SP1 (Sp1 Transcription Factor) (MaxLight 490)
MBS6208680-01 0.1 mL

SP1 (Sp1 Transcription Factor) (MaxLight 490)

Sign In for Pricing
View Details
SP1 (Sp1 Transcription Factor) (MaxLight 490)
MBS6208680-02 5x 0.1 mL

SP1 (Sp1 Transcription Factor) (MaxLight 490)

Sign In for Pricing
View Details
GFER, ID (GFER, ALR, HERV1, HPO, FAD-linked sulfhydryl oxidase ALR, Augmenter of liver regeneration, Hepatopoietin) (Biotin) discontinued
035999-Biotin 200 µL

GFER, ID (GFER, ALR, HERV1, HPO, FAD-linked sulfhydryl oxidase ALR, Augmenter of liver regeneration, Hepatopoietin) (Biotin) discontinued

Sign In for Pricing
View Details
Lentiviral human FAM171A1 sgRNA gene knockout kit - Lentiviral human FAM171A1 sgRNA gene knockout kit (plasmid)
GTR15365900 1 Vial

Lentiviral human FAM171A1 sgRNA gene knockout kit - Lentiviral human FAM171A1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details