Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX5 Rabbit Polyclonal Antibody (HRP)

CBX5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HP1, HP1A, HEL25

UniProt

P45973

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CBX5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_036249

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAT3 Antibody
8C10170-AAT 50 µg

LAT3 Antibody

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2), CF640R conjugate, 0.1mg/mL
BNC400523-500 1x 500 µL

AFP (Alpha Fetoprotein) (C2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SEMA3A (Semaphorin 3A) CLIA Kit
E-CL-H0829-01 24 Tests

Human SEMA3A (Semaphorin 3A) CLIA Kit

Sign In for Pricing
View Details
Human SEMA3A (Semaphorin 3A) CLIA Kit
E-CL-H0829-02 48 Tests

Human SEMA3A (Semaphorin 3A) CLIA Kit

Sign In for Pricing
View Details
Human SEMA3A (Semaphorin 3A) CLIA Kit
E-CL-H0829-03 96 Tests

Human SEMA3A (Semaphorin 3A) CLIA Kit

Sign In for Pricing
View Details
Rat IL-12 Antibody Pair Set
E-KAB-0377 50 µL & 100 µg

Rat IL-12 Antibody Pair Set

Sign In for Pricing
View Details