Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIN3A Rabbit Polyclonal Antibody (HRP)

SIN3A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

WITKOS

UniProt

Q96ST3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SIN3A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

145kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_056292

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TITF1 (NK2 Homeobox 1, BCH, BHC, NK-2, NKX2.1, NKX2A, TEBP, TITF1, TTF-1, TTF1) (MaxLight 550)
MBS6219675-01 0.1 mL

TITF1 (NK2 Homeobox 1, BCH, BHC, NK-2, NKX2.1, NKX2A, TEBP, TITF1, TTF-1, TTF1) (MaxLight 550)

Sign In for Pricing
View Details
TITF1 (NK2 Homeobox 1, BCH, BHC, NK-2, NKX2.1, NKX2A, TEBP, TITF1, TTF-1, TTF1) (MaxLight 550)
MBS6219675-02 5x 0.1 mL

TITF1 (NK2 Homeobox 1, BCH, BHC, NK-2, NKX2.1, NKX2A, TEBP, TITF1, TTF-1, TTF1) (MaxLight 550)

Sign In for Pricing
View Details
LOC687808 3'UTR Luciferase Stable Cell Line
TU211599 1.0 mL

LOC687808 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MAPK12 (Mitogen-activated Protein Kinase 12, MAPK 12, MAP Kinase 12, PRKM12, Extracellular Signal-regulated Kinase 6, ERK6, ERK-6, Mitogen-activated Protein Kinase p38 gamma, MAP Kinase p38 gamma, P38gamma, Stress-activated Protein Kinase 3, SAPK3, SAPK-3) (APC)
129398-APC 100 µL

MAPK12 (Mitogen-activated Protein Kinase 12, MAPK 12, MAP Kinase 12, PRKM12, Extracellular Signal-regulated Kinase 6, ERK6, ERK-6, Mitogen-activated Protein Kinase p38 gamma, MAP Kinase p38 gamma, P38gamma, Stress-activated Protein Kinase 3, SAPK3, SAPK-3) (APC)

Sign In for Pricing
View Details
SF3A3 Rabbit Polyclonal Antibody (PerCP)
orb2466883 100 µL

SF3A3 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Wnt3a (Wingless-type MMTV (Mouse Mammary Tumor Virus) Integration Site Family Member) (MaxLight 750) discontinued
W3011-03-ML750 100 µL

Wnt3a (Wingless-type MMTV (Mouse Mammary Tumor Virus) Integration Site Family Member) (MaxLight 750) discontinued

Sign In for Pricing
View Details