Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCOA3 Rabbit Polyclonal Antibody (HRP)

NCOA3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ACTR, AIB1, RAC3, SRC3, pCIP, AIB-1, CTG26, SRC-3, CAGH16, KAT13B, TNRC14, TNRC16, TRAM-1, bHLHe42

UniProt

Q0VF45

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NCOA3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

155kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_006525

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue, Total Protein, Human Adult Normal, Fallopian Tube
MBS656983-01 1 mg

Tissue, Total Protein, Human Adult Normal, Fallopian Tube

Sign In for Pricing
View Details
Tissue, Total Protein, Human Adult Normal, Fallopian Tube
MBS656983-02 5x 1 mg

Tissue, Total Protein, Human Adult Normal, Fallopian Tube

Sign In for Pricing
View Details
TSKU Protein Vector (Human) (pPB-C-His)
PV044197 500 ng

TSKU Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Bothrops erythromelas NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)
MBS7022105-01 0.02 mg

Recombinant Bothrops erythromelas NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Sign In for Pricing
View Details
Recombinant Bothrops erythromelas NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)
MBS7022105-02 0.1 mg

Recombinant Bothrops erythromelas NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Sign In for Pricing
View Details
Recombinant Bothrops erythromelas NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)
MBS7022105-03 5x 0.1 mg

Recombinant Bothrops erythromelas NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Sign In for Pricing
View Details