Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIP1 Rabbit Polyclonal Antibody (HRP)

GRIP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GRIP, FRASRS3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GRIP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MIAVSFKCRCQILRRLTKDESPYTKSASQTKPPDGALAVRRQSIPEEFKG

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

117kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_290559

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep T-Lymphoma Invasion and Metastasis-Inducing Protein 1 (TIAM1) ELISA Kit
OM622607 96 Strip Well

Sheep T-Lymphoma Invasion and Metastasis-Inducing Protein 1 (TIAM1) ELISA Kit

Sign In for Pricing
View Details
Human WDR81 Recombinant Protein, N-His
ARO-P20073-01 50 µg

Human WDR81 Recombinant Protein, N-His

Sign In for Pricing
View Details
Human WDR81 Recombinant Protein, N-His
ARO-P20073-02 100 µg

Human WDR81 Recombinant Protein, N-His

Sign In for Pricing
View Details
Human WDR81 Recombinant Protein, N-His
ARO-P20073-03 1 mg

Human WDR81 Recombinant Protein, N-His

Sign In for Pricing
View Details
Human IL5RA Pre-designed siRNA Set B
SI007625B 1 Each

Human IL5RA Pre-designed siRNA Set B

Sign In for Pricing
View Details
[4-[ (E) -2- (1H-indazol-3-yl) ethenyl]phenyl]-piperazin-1-ylmethanone
FI153964 25 mg

[4-[ (E) -2- (1H-indazol-3-yl) ethenyl]phenyl]-piperazin-1-ylmethanone

Sign In for Pricing
View Details