Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOS Rabbit Polyclonal Antibody (FITC)

FOS Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P55, AP-1, C-FOS

UniProt

P01100

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FOS

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_005243

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Parotid gland
CS500822 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), Biotin conjugate, 0.1mg/mL
BNCB2167-500 1x 500 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LENG1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E6]
TA503084BM 100 µL

LENG1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E6]

Sign In for Pricing
View Details
Chromogranin A (PHE5), CF640R conjugate, 0.1mg/mL
BNC400461-100 1x 100 µL

Chromogranin A (PHE5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA DMB (HLA-DMB) (NM_002118) Human Recombinant Protein
TP303811 20 µg

HLA DMB (HLA-DMB) (NM_002118) Human Recombinant Protein

Sign In for Pricing
View Details
BRAF Antibody
KC-6286-01 50 μL

BRAF Antibody

Sign In for Pricing
View Details