Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOS Rabbit Polyclonal Antibody (FITC)

FOS Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P55, AP-1, C-FOS

UniProt

P01100

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FOS

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_005243

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS623784 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
IDH3G (NM_004135) Human Over-expression Lysate
LY418190 100 µg

IDH3G (NM_004135) Human Over-expression Lysate

Sign In for Pricing
View Details
HDAC10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6G5]
TA500725BM 100 µL

HDAC10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6G5]

Sign In for Pricing
View Details
Uncoated Human CA125 (CarbohydUncoated Rate Antigen 125) ELISA Kit
E-UNEL-H0030-01 5x 96 Tests

Uncoated Human CA125 (CarbohydUncoated Rate Antigen 125) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human CA125 (CarbohydUncoated Rate Antigen 125) ELISA Kit
E-UNEL-H0030-02 15x 96 Tests

Uncoated Human CA125 (CarbohydUncoated Rate Antigen 125) ELISA Kit

Sign In for Pricing
View Details
Human CLEC2D activation kit by CRISPRa
GA109251 1 Kit

Human CLEC2D activation kit by CRISPRa

Sign In for Pricing
View Details