Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOS Rabbit Polyclonal Antibody (Biotin)

FOS Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P55, AP-1, C-FOS

UniProt

P01100

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FOS

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_005243

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTM4 (Glutathione S-transferase Mu 4 Isoform 1, GST Class-mu 4, GST-Mu2, GSTM4-4, MGC131945, MGC9247) (Biotin)
127602-Biotin 100 µL

GSTM4 (Glutathione S-transferase Mu 4 Isoform 1, GST Class-mu 4, GST-Mu2, GSTM4-4, MGC131945, MGC9247) (Biotin)

Sign In for Pricing
View Details
LOC100359635 3'UTR Luciferase Stable Cell Line
TU207262 1.0 mL

LOC100359635 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal IMP2/IGF2BP2 Antibody
NBP2-33992 0.1 mL

Rabbit Polyclonal IMP2/IGF2BP2 Antibody

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At5g61290 Polyclonal Antibody
MBS9006916 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) At5g61290 Polyclonal Antibody

Sign In for Pricing
View Details
Cc2d1b 3'UTR Luciferase Stable Cell Line
TU103210 1.0 mL

Cc2d1b 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
pDNR-LIB-AGL Plasmid
PVT28883 2 µg

pDNR-LIB-AGL Plasmid

Sign In for Pricing
View Details