Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR5A2 Rabbit Polyclonal Antibody (HRP)

NR5A2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B1F, CPF, FTF, B1F2, LRH1, LRH-1, FTZ-F1, hB1F-2, FTZ-F1beta

UniProt

O60587

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NR5A2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LPPTDYDRSPFVTSPISMTMLHGSLQGYQTYGHFPSRAIKSEYPDPYTSS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

AAD03248

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM39A Protein Vector (Mouse) (pPB-N-His)
PV239663 500 ng

TMEM39A Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
NTRK2 (TRKB, BDNF/NT-3 Growth Factors Receptor, GP145-TrkB, Neurotrophic Tyrosine Kinase Receptor Type 2, TrkB Tyrosine Kinase, Tropomyosin-related Kinase B) (MaxLight 650)
MBS6223556-01 0.1 mL

NTRK2 (TRKB, BDNF/NT-3 Growth Factors Receptor, GP145-TrkB, Neurotrophic Tyrosine Kinase Receptor Type 2, TrkB Tyrosine Kinase, Tropomyosin-related Kinase B) (MaxLight 650)

Sign In for Pricing
View Details
NTRK2 (TRKB, BDNF/NT-3 Growth Factors Receptor, GP145-TrkB, Neurotrophic Tyrosine Kinase Receptor Type 2, TrkB Tyrosine Kinase, Tropomyosin-related Kinase B) (MaxLight 650)
MBS6223556-02 5x 0.1 mL

NTRK2 (TRKB, BDNF/NT-3 Growth Factors Receptor, GP145-TrkB, Neurotrophic Tyrosine Kinase Receptor Type 2, TrkB Tyrosine Kinase, Tropomyosin-related Kinase B) (MaxLight 650)

Sign In for Pricing
View Details
PCDH10 Antibody Blocking Peptide
orb1513018 500 µg

PCDH10 Antibody Blocking Peptide

Sign In for Pricing
View Details
Lentiviral human RCN3 shRNA (UAS) - Lentiviral human RCN3 shRNA (UAS, RFP) (25)
GTR15137291 1 Vial

Lentiviral human RCN3 shRNA (UAS) - Lentiviral human RCN3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
GYS1 , Human (His)
HY-P704235 50 µg

GYS1 , Human (His)

Sign In for Pricing
View Details