Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ebf3 Rabbit Polyclonal Antibody (FITC)

Ebf3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

D4A274

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MNPVRSWMHTAGVVDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001101976

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP6, Recombinant, Human, aa382-513, His-Tag (Bone Morphogenetic Protein 6)
372464-01 20 µg

BMP6, Recombinant, Human, aa382-513, His-Tag (Bone Morphogenetic Protein 6)

Sign In for Pricing
View Details
BMP6, Recombinant, Human, aa382-513, His-Tag (Bone Morphogenetic Protein 6)
372464-02 100 µg

BMP6, Recombinant, Human, aa382-513, His-Tag (Bone Morphogenetic Protein 6)

Sign In for Pricing
View Details
BMP6, Recombinant, Human, aa382-513, His-Tag (Bone Morphogenetic Protein 6)
372464-03 1 mg

BMP6, Recombinant, Human, aa382-513, His-Tag (Bone Morphogenetic Protein 6)

Sign In for Pricing
View Details
Rat Anti-Mouse CD40-UNLB
MBS673353-01 0.5 mg

Rat Anti-Mouse CD40-UNLB

Sign In for Pricing
View Details
Rat Anti-Mouse CD40-UNLB
MBS673353-02 5x 0.5 mg

Rat Anti-Mouse CD40-UNLB

Sign In for Pricing
View Details
Rabbit DUSP12 Antibody
orb1520801-01 10 µL

Rabbit DUSP12 Antibody

Sign In for Pricing
View Details